![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
![]() | Protein automated matches [190168] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries) |
![]() | Domain d3hcaa1: 3hca A:24-280 [177366] Other proteins in same PDB: d3hcaa2, d3hcab2 automated match to d1hnnb_ complexed with edo, otr, sah |
PDB Entry: 3hca (more details), 2.4 Å
SCOPe Domain Sequences for d3hcaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hcaa1 c.66.1.15 (A:24-280) automated matches {Human (Homo sapiens) [TaxId: 9606]} asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk erqlrarvkrvlpidvhqpqplgagspaplpadalvsafclqavspdlasfqraldhitt llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq tgvddvkgvffawaqkv
Timeline for d3hcaa1: