Lineage for d3hcaa1 (3hca A:24-280)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469291Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 protein domains)
    automatically mapped to Pfam PF01234
  6. 2469313Protein automated matches [190168] (1 species)
    not a true protein
  7. 2469314Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)
  8. 2469319Domain d3hcaa1: 3hca A:24-280 [177366]
    Other proteins in same PDB: d3hcaa2, d3hcab2
    automated match to d1hnnb_
    complexed with edo, otr, sah

Details for d3hcaa1

PDB Entry: 3hca (more details), 2.4 Å

PDB Description: Crystal Structure of E185Q hPNMT in Complex With Octopamine and AdoHcy
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3hcaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcaa1 c.66.1.15 (A:24-280) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafclqavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv

SCOPe Domain Coordinates for d3hcaa1:

Click to download the PDB-style file with coordinates for d3hcaa1.
(The format of our PDB-style files is described here.)

Timeline for d3hcaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hcaa2