Lineage for d3hbha_ (3hbh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926572Species Picea abies [TaxId:3329] [188984] (3 PDB entries)
  8. 2926575Domain d3hbha_: 3hbh A: [177361]
    automated match to d1dxja_

Details for d3hbha_

PDB Entry: 3hbh (more details), 2.25 Å

PDB Description: Class IV chitinase structure from Picea abies at 2.25A
PDB Compounds: (A:) Class IV chitinase Chia4-Pa2

SCOPe Domain Sequences for d3hbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbha_ d.2.1.0 (A:) automated matches {Picea abies [TaxId: 3329]}
svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
ssrvnyykkicsqlgvdpganvsc

SCOPe Domain Coordinates for d3hbha_:

Click to download the PDB-style file with coordinates for d3hbha_.
(The format of our PDB-style files is described here.)

Timeline for d3hbha_: