Lineage for d1aw9a1 (1aw9 A:83-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326349Protein Class phi GST [81356] (3 species)
  7. 2326357Species Maize (Zea mays), type III [TaxId:4577] [47637] (1 PDB entry)
  8. 2326358Domain d1aw9a1: 1aw9 A:83-217 [17736]
    Other proteins in same PDB: d1aw9a2
    complexed with cd

Details for d1aw9a1

PDB Entry: 1aw9 (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form
PDB Compounds: (A:) glutathione s-transferase III

SCOPe Domain Sequences for d1aw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
gtdllpatasaaklevwleveshhfypnasplvfqllvrpllggapdaavvdkhaeqlak
vldvyeahlarnkylagdeftladanhasyllylsktpkaglvaarphvkawweaivarp
afqktvaaiplpppp

SCOPe Domain Coordinates for d1aw9a1:

Click to download the PDB-style file with coordinates for d1aw9a1.
(The format of our PDB-style files is described here.)

Timeline for d1aw9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aw9a2