SCOPe 2.05: Domain d1aw9a1: 1aw9 A:83-217

Lineage for d1aw9a1 (1aw9 A:83-217)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class phi GST [81356] (3 species)

7. Species Maize (Zea mays), type III [TaxId:4577] [47637] (1 PDB entry)

8. Domain d1aw9a1: 1aw9 A:83-217 [17736]
   Other proteins in same PDB: d1aw9a2
   complexed with cd

Details for d1aw9a1

PDB Entry: 1aw9, 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form

PDB Compounds: (A:) glutathione s-transferase III

SCOPe Domain Sequences for d1aw9a1:

Sequence; same for both SEQRES and ATOM records:

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
gtdllpatasaaklevwleveshhfypnasplvfqllvrpllggapdaavvdkhaeqlak
vldvyeahlarnkylagdeftladanhasyllylsktpkaglvaarphvkawweaivarp
afqktvaaiplpppp

Timeline for d1aw9a1:

• d1aw9a1 first appeared (with stable ids) in SCOP 1.55, called d1aw9_1
  
• d1aw9a1 appears in SCOPe 2.04
  
• d1aw9a1 appears in SCOPe 2.06
  
• d1aw9a1 appears in the current release, SCOPe 2.08