| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class phi GST [81356] (3 species) |
| Species Maize (Zea mays), type III [TaxId:4577] [47637] (1 PDB entry) |
| Domain d1aw9a1: 1aw9 A:83-217 [17736] Other proteins in same PDB: d1aw9a2 complexed with cd |
PDB Entry: 1aw9 (more details), 2.2 Å
SCOPe Domain Sequences for d1aw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
gtdllpatasaaklevwleveshhfypnasplvfqllvrpllggapdaavvdkhaeqlak
vldvyeahlarnkylagdeftladanhasyllylsktpkaglvaarphvkawweaivarp
afqktvaaiplpppp
Timeline for d1aw9a1: