Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (9 species) not a true protein |
Species Picea abies [TaxId:3329] [188984] (3 PDB entries) |
Domain d3hbex_: 3hbe X: [177359] automated match to d1dxja_ complexed with act, for, mxe |
PDB Entry: 3hbe (more details), 1.55 Å
SCOPe Domain Sequences for d3hbex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbex_ d.2.1.0 (X:) automated matches {Picea abies [TaxId: 3329]} svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev ssrvnyykkicsqlgvdpganvsc
Timeline for d3hbex_: