SCOPe 2.07: Domain d3hbda_: 3hbd A:

Lineage for d3hbda_ (3hbd A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (13 species)
   not a true protein

7. Species Picea abies [TaxId:3329] [188984] (3 PDB entries)

8. Domain d3hbda_: 3hbd A: [177358]
   automated match to d1dxja_
   complexed with act, mxe

Details for d3hbda_

PDB Entry: 3hbd, 1.8 Å

PDB Description: Class IV chitinase structure from Picea abies at 1.8A

PDB Compounds: (A:) Class IV chitinase Chia4-Pa2

SCOPe Domain Sequences for d3hbda_:

Sequence; same for both SEQRES and ATOM records:

>d3hbda_ d.2.1.0 (A:) automated matches {Picea abies [TaxId: 3329]}
svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
ssrvnyykkicsqlgvdpganvsc

Timeline for d3hbda_:

• d3hbda_ first appeared in SCOPe 2.01
  
• d3hbda_ appears in SCOPe 2.06