![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Picea abies [TaxId:3329] [188984] (3 PDB entries) |
![]() | Domain d3hbda_: 3hbd A: [177358] automated match to d1dxja_ complexed with act, mxe |
PDB Entry: 3hbd (more details), 1.8 Å
SCOPe Domain Sequences for d3hbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbda_ d.2.1.0 (A:) automated matches {Picea abies [TaxId: 3329]} svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev ssrvnyykkicsqlgvdpganvsc
Timeline for d3hbda_: