Lineage for d3hb6a_ (3hb6 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620686Protein Catalase I [56636] (8 species)
  7. 2620757Species Proteus mirabilis [TaxId:584] [56640] (11 PDB entries)
  8. 2620763Domain d3hb6a_: 3hb6 A: [177357]
    automated match to d1e93a_
    complexed with gol, hem, so4; mutant

Details for d3hb6a_

PDB Entry: 3hb6 (more details), 2.3 Å

PDB Description: inactive mutant h54f of proteus mirabilis catalase
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d3hb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb6a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmfakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle

SCOPe Domain Coordinates for d3hb6a_:

Click to download the PDB-style file with coordinates for d3hb6a_.
(The format of our PDB-style files is described here.)

Timeline for d3hb6a_: