Lineage for d3hb3c_ (3hb3 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356469Domain d3hb3c_: 3hb3 C: [177355]
    Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3b2
    automated match to d1mqkh_
    complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3c_

PDB Entry: 3hb3 (more details), 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase
PDB Compounds: (C:) antibody fv fragment

SCOPe Domain Sequences for d3hb3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb3c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

SCOPe Domain Coordinates for d3hb3c_:

Click to download the PDB-style file with coordinates for d3hb3c_.
(The format of our PDB-style files is described here.)

Timeline for d3hb3c_: