Lineage for d3haxc_ (3hax C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037379Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 3037380Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 3037387Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 3037391Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
    Uniprot Q8U1R4 4-55
  8. 3037392Domain d3haxc_: 3hax C: [177353]
    automated match to d2hvyc1
    protein/RNA complex; complexed with edo, mg, pg4, pge, zn

Details for d3haxc_

PDB Entry: 3hax (more details), 2.11 Å

PDB Description: crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
PDB Compounds: (C:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d3haxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3haxc_ g.41.16.1 (C:) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOPe Domain Coordinates for d3haxc_:

Click to download the PDB-style file with coordinates for d3haxc_.
(The format of our PDB-style files is described here.)

Timeline for d3haxc_: