SCOPe 2.01: Domain d3hala_: 3hal A:

Lineage for d3hala_ (3hal A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [189149] (1 PDB entry)

8. Domain d3hala_: 3hal A: [177344]
   automated match to d1jt3b_
   complexed with cl, so4

Details for d3hala_

PDB Entry: 3hal, 1.8 Å

PDB Description: Crystal structure of Rabbit acidic fibroblast growth factor

PDB Compounds: (A:) Fibroblast growth factor 1 isoform 1

SCOPe Domain Sequences for d3hala_:

Sequence; same for both SEQRES and ATOM records:

>d3hala_ b.42.1.1 (A:) Acidic FGF (FGF1) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
mdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg
qkailflplpv

Timeline for d3hala_:

• d3hala_ is new in SCOPe 2.01-stable
  
• d3hala_ appears in SCOPe 2.02
  
• d3hala_ appears in the current release, SCOPe 2.08