![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
![]() | Protein Acidic FGF (FGF1) [50357] (4 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [189149] (1 PDB entry) |
![]() | Domain d3hala_: 3hal A: [177344] automated match to d1jt3b_ complexed with cl, so4 |
PDB Entry: 3hal (more details), 1.8 Å
SCOPe Domain Sequences for d3hala_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hala_ b.42.1.1 (A:) Acidic FGF (FGF1) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} nyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla mdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg qkailflplpv
Timeline for d3hala_: