SCOPe 2.05: Domain d1byec1: 1bye C:81-213

Lineage for d1byec1 (1bye C:81-213)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class phi GST [81356] (3 species)
Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
Domain d1byec1: 1bye C:81-213 [17734]
Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2
complexed with ata

Details for d1byec1

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

PDB Compounds: (C:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1byec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byec1 a.45.1.1 (C:81-213) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

SCOPe Domain Coordinates for d1byec1:

Click to download the PDB-style file with coordinates for d1byec1.
(The format of our PDB-style files is described here.)

Timeline for d1byec1: