SCOP 1.57: Domain d1byec1: 1bye C:81-213

Lineage for d1byec1 (1bye C:81-213)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)

8. Domain d1byec1: 1bye C:81-213 [17734]
   Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2

Details for d1byec1

PDB Entry: 1bye, 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byec1:

Sequence; same for both SEQRES and ATOM records:

>d1byec1 a.45.1.1 (C:81-213) Glutathione S-transferase {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

Timeline for d1byec1:

• d1byec1 first appeared (with stable ids) in SCOP 1.55
  
• d1byec1 appears in SCOP 1.59
  
• d1byec1 appears in the current release, SCOPe 2.08