SCOPe 2.08: Domain d3ha6a1: 3ha6 A:125-388

Lineage for d3ha6a1 (3ha6 A:125-388)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3ha6a1: 3ha6 A:125-388 [177338]
   Other proteins in same PDB: d3ha6a2
   automated match to d1ol5a_
   complexed with 2jz

Details for d3ha6a1

PDB Entry: 3ha6, 2.36 Å

PDB Description: Crystal structure of aurora A in complex with TPX2 and compound 10

PDB Compounds: (A:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3ha6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ha6a1 d.144.1.7 (A:125-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitanss

Timeline for d3ha6a1:

• d3ha6a1 first appeared in SCOPe 2.01, called d3ha6a_
  
• d3ha6a1 appears in SCOPe 2.07