SCOPe 2.08: Domain d3h9rb_: 3h9r B:

Lineage for d3h9rb_ (3h9r B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)

8. Domain d3h9rb_: 3h9r B: [177336]
   Other proteins in same PDB: d3h9ra_
   automated match to d1a7xa_
   complexed with pg4, so4, tak

Details for d3h9rb_

PDB Entry: 3h9r, 2.35 Å

PDB Description: Crystal structure of the kinase domain of type I activin receptor (ACVR1) in complex with FKBP12 and dorsomorphin

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d3h9rb_:

Sequence; same for both SEQRES and ATOM records:

>d3h9rb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d3h9rb_:

• d3h9rb_ first appeared in SCOPe 2.01
  
• d3h9rb_ appears in SCOPe 2.07