Lineage for d3h9db_ (3h9d B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638610Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189068] (1 PDB entry)
  8. 1638612Domain d3h9db_: 3h9d B: [177332]
    automated match to d1gnua_
    complexed with ca

Details for d3h9db_

PDB Entry: 3h9d (more details), 2.3 Å

PDB Description: Crystal Structure of Trypanosoma brucei ATG8
PDB Compounds: (B:) Microtubule-associated protein 1A/1B, light chain 3, putative

SCOPe Domain Sequences for d3h9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h9db_ d.15.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltvgqf
vsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg

SCOPe Domain Coordinates for d3h9db_:

Click to download the PDB-style file with coordinates for d3h9db_.
(The format of our PDB-style files is described here.)

Timeline for d3h9db_: