Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189068] (1 PDB entry) |
Domain d3h9db_: 3h9d B: [177332] automated match to d1gnua_ complexed with ca |
PDB Entry: 3h9d (more details), 2.3 Å
SCOPe Domain Sequences for d3h9db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h9db_ d.15.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} kdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltvgqf vsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg
Timeline for d3h9db_: