Lineage for d1byeb1 (1bye B:81-213)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48215Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 48219Domain d1byeb1: 1bye B:81-213 [17733]
    Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2

Details for d1byeb1

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byeb1 a.45.1.1 (B:81-213) Glutathione S-transferase {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

SCOP Domain Coordinates for d1byeb1:

Click to download the PDB-style file with coordinates for d1byeb1.
(The format of our PDB-style files is described here.)

Timeline for d1byeb1: