![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class phi GST [81356] (3 species) |
![]() | Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries) |
![]() | Domain d1byeb1: 1bye B:81-213 [17733] Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2 complexed with ata |
PDB Entry: 1bye (more details), 2.8 Å
SCOPe Domain Sequences for d1byeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byeb1 a.45.1.1 (B:81-213) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp svqkvaalmkpsa
Timeline for d1byeb1: