Lineage for d3h93a1 (3h93 A:4-192)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880208Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189148] (7 PDB entries)
  8. 2880211Domain d3h93a1: 3h93 A:4-192 [177328]
    Other proteins in same PDB: d3h93a2
    automated match to d1beda_
    complexed with gol

Details for d3h93a1

PDB Entry: 3h93 (more details), 1.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa dsba
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3h93a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h93a1 c.47.1.0 (A:4-192) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ddytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrl
palfggiwnvhgqmfltlesmgvehdvhnavfeaihkehkklatpeemadflagkgvdke
kflstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladyli
ekeraaakk

SCOPe Domain Coordinates for d3h93a1:

Click to download the PDB-style file with coordinates for d3h93a1.
(The format of our PDB-style files is described here.)

Timeline for d3h93a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h93a2