Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein automated matches [191035] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188859] (13 PDB entries) |
Domain d3h91a_: 3h91 A: [177326] automated match to d2dnva1 protein/DNA complex |
PDB Entry: 3h91 (more details), 1.5 Å
SCOPe Domain Sequences for d3h91a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h91a_ b.34.13.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqk
Timeline for d3h91a_: