Lineage for d3h86c_ (3h86 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123827Protein automated matches [190087] (10 species)
    not a true protein
  7. 2123875Species Methanococcus maripaludis [TaxId:39152] [189067] (1 PDB entry)
  8. 2123878Domain d3h86c_: 3h86 C: [177320]
    automated match to d1ki9b_
    complexed with ap5

Details for d3h86c_

PDB Entry: 3h86 (more details), 2.5 Å

PDB Description: crystal structure of adenylate kinase from methanococcus maripaludis
PDB Compounds: (C:) adenylate kinase

SCOPe Domain Sequences for d3h86c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h86c_ c.37.1.1 (C:) automated matches {Methanococcus maripaludis [TaxId: 39152]}
knkvvvvtgvpgvggttvtqkamdilseeglnykmvnfgsamfdvaneeglasdrdqmrk
ldpetqkriqkmagrkiaemakespvavdthstvktpkgylpglpawvltelnpdivivv
etdgdeilmrrlsdesrkrdlettasieehqfmnraaamsygvltgatvkivknknglvd
naveelmsvlr

SCOPe Domain Coordinates for d3h86c_:

Click to download the PDB-style file with coordinates for d3h86c_.
(The format of our PDB-style files is described here.)

Timeline for d3h86c_: