SCOPe 2.05: Domain d3h86c_: 3h86 C:

Lineage for d3h86c_ (3h86 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (8 species)
   not a true protein

7. Species Methanococcus maripaludis [TaxId:39152] [189067] (1 PDB entry)

8. Domain d3h86c_: 3h86 C: [177320]
   automated match to d1ki9b_
   complexed with ap5

Details for d3h86c_

PDB Entry: 3h86, 2.5 Å

PDB Description: crystal structure of adenylate kinase from methanococcus maripaludis

PDB Compounds: (C:) adenylate kinase

SCOPe Domain Sequences for d3h86c_:

Sequence; same for both SEQRES and ATOM records:

>d3h86c_ c.37.1.1 (C:) automated matches {Methanococcus maripaludis [TaxId: 39152]}
knkvvvvtgvpgvggttvtqkamdilseeglnykmvnfgsamfdvaneeglasdrdqmrk
ldpetqkriqkmagrkiaemakespvavdthstvktpkgylpglpawvltelnpdivivv
etdgdeilmrrlsdesrkrdlettasieehqfmnraaamsygvltgatvkivknknglvd
naveelmsvlr

Timeline for d3h86c_:

• d3h86c_ first appeared in SCOPe 2.01
  
• d3h86c_ appears in SCOPe 2.04
  
• d3h86c_ appears in SCOPe 2.06
  
• d3h86c_ appears in the current release, SCOPe 2.08