SCOPe 2.08: Domain d1byea1: 1bye A:81-213

Lineage for d1byea1 (1bye A:81-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class phi GST [81356] (3 species)

7. Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)

8. Domain d1byea1: 1bye A:81-213 [17732]
   Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2
   complexed with ata

Details for d1byea1

PDB Entry: 1bye, 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

PDB Compounds: (A:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1byea1:

Sequence; same for both SEQRES and ATOM records:

>d1byea1 a.45.1.1 (A:81-213) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

Timeline for d1byea1:

• d1byea1 first appeared (with stable ids) in SCOP 1.55
  
• d1byea1 appears in SCOPe 2.07