Lineage for d3h86a_ (3h86 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866297Species Methanococcus maripaludis [TaxId:39152] [189067] (1 PDB entry)
  8. 2866298Domain d3h86a_: 3h86 A: [177318]
    automated match to d1ki9b_
    complexed with ap5

Details for d3h86a_

PDB Entry: 3h86 (more details), 2.5 Å

PDB Description: crystal structure of adenylate kinase from methanococcus maripaludis
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3h86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h86a_ c.37.1.1 (A:) automated matches {Methanococcus maripaludis [TaxId: 39152]}
knkvvvvtgvpgvggttvtqkamdilseeglnykmvnfgsamfdvaneeglasdrdqmrk
ldpetqkriqkmagrkiaemakespvavdthstvktpkgylpglpawvltelnpdivivv
etdgdeilmrrlsdesrkrdlettasieehqfmnraaamsygvltgatvkivknknglvd
naveelmsvlr

SCOPe Domain Coordinates for d3h86a_:

Click to download the PDB-style file with coordinates for d3h86a_.
(The format of our PDB-style files is described here.)

Timeline for d3h86a_: