Lineage for d3h82a_ (3h82 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427979Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1428137Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 1428141Protein automated matches [191006] (1 species)
    not a true protein
  7. 1428142Species Human (Homo sapiens) [TaxId:9606] [188753] (8 PDB entries)
  8. 1428146Domain d3h82a_: 3h82 A: [177316]
    Other proteins in same PDB: d3h82b_
    automated match to d1p97a_
    protein/DNA complex; complexed with 020

Details for d3h82a_

PDB Entry: 3h82 (more details), 1.5 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d3h82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h82a_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshq
nlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

SCOPe Domain Coordinates for d3h82a_:

Click to download the PDB-style file with coordinates for d3h82a_.
(The format of our PDB-style files is described here.)

Timeline for d3h82a_: