| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins) contains PAC motif |
| Protein automated matches [191006] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries) |
| Domain d3h7wa1: 3h7w A:239-349 [177314] Other proteins in same PDB: d3h7wa2, d3h7wb_ automated match to d1p97a_ protein/DNA complex; complexed with 018 |
PDB Entry: 3h7w (more details), 1.65 Å
SCOPe Domain Sequences for d3h7wa1:
Sequence, based on SEQRES records: (download)
>d3h7wa1 d.110.3.7 (A:239-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek
>d3h7wa1 d.110.3.7 (A:239-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseiek
Timeline for d3h7wa1: