Lineage for d1axdb1 (1axd B:81-210)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326349Protein Class phi GST [81356] (3 species)
  7. 2326350Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 2326352Domain d1axdb1: 1axd B:81-210 [17731]
    Other proteins in same PDB: d1axda2, d1axdb2

Details for d1axdb1

PDB Entry: 1axd (more details), 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione
PDB Compounds: (B:) glutathione s-transferase I

SCOPe Domain Sequences for d1axdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axdb1 a.45.1.1 (B:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalm

SCOPe Domain Coordinates for d1axdb1:

Click to download the PDB-style file with coordinates for d1axdb1.
(The format of our PDB-style files is described here.)

Timeline for d1axdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axdb2