SCOPe 2.06: Domain d3h7ob_: 3h7o B:

Lineage for d3h7ob_ (3h7o B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Sarcoptes scabiei [TaxId:197185] [188883] (2 PDB entries)

8. Domain d3h7ob_: 3h7o B: [177309]
   automated match to d1fxya_
   complexed with gol, so4

Details for d3h7ob_

PDB Entry: 3h7o, 1.85 Å

PDB Description: crystal structure of scabies mite inactivated protease paralogue s-i1 (smipp-s-i1)

PDB Compounds: (B:) Group 3 allergen SMIPP-S Yv6023A04

SCOPe Domain Sequences for d3h7ob_:

Sequence, based on SEQRES records:

>d3h7ob_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
gektdikqvpwtvavrtypgeesltcggailsqwfvltaahcvfdqkpetiviqyestnl
wedpgksdpyvshvylsfyrqetmendiailelsrplkldglkskpaklpdiefrpktgs
dvlvsgygdgqtmdpkdhdlksaqltvvdldecrtkygpiflslqvfcaqkvgvslesgd
agdptvqqdtlvgvaayfpkrpegapevftkvgsyvswiqdiikkk

Sequence, based on observed residues (ATOM records):

>d3h7ob_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
gektdikqvpwtvavrtypgeesltcggailsqwfvltaahcvfdqkpetiviqyestnl
wedpgksdpyvshvylsfyrqetmendiailelsrplkldglkskpaklpdiefrpktgs
dvlvsgygdgtmdpkdhdlksaqltvvdldecrtkygpiflslqvfcaqkvgvslesgda
gdptvqqdtlvgvaayfpkrpegapevftkvgsyvswiqdiikkk

Timeline for d3h7ob_:

• d3h7ob_ first appeared in SCOPe 2.01
  
• d3h7ob_ appears in SCOPe 2.05
  
• d3h7ob_ appears in SCOPe 2.07
  
• d3h7ob_ appears in the current release, SCOPe 2.08