Lineage for d3h7ob_ (3h7o B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058323Species Sarcoptes scabiei [TaxId:197185] [188883] (2 PDB entries)
  8. 2058325Domain d3h7ob_: 3h7o B: [177309]
    automated match to d1fxya_
    complexed with gol, so4

Details for d3h7ob_

PDB Entry: 3h7o (more details), 1.85 Å

PDB Description: crystal structure of scabies mite inactivated protease paralogue s-i1 (smipp-s-i1)
PDB Compounds: (B:) Group 3 allergen SMIPP-S Yv6023A04

SCOPe Domain Sequences for d3h7ob_:

Sequence, based on SEQRES records: (download)

>d3h7ob_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
gektdikqvpwtvavrtypgeesltcggailsqwfvltaahcvfdqkpetiviqyestnl
wedpgksdpyvshvylsfyrqetmendiailelsrplkldglkskpaklpdiefrpktgs
dvlvsgygdgqtmdpkdhdlksaqltvvdldecrtkygpiflslqvfcaqkvgvslesgd
agdptvqqdtlvgvaayfpkrpegapevftkvgsyvswiqdiikkk

Sequence, based on observed residues (ATOM records): (download)

>d3h7ob_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
gektdikqvpwtvavrtypgeesltcggailsqwfvltaahcvfdqkpetiviqyestnl
wedpgksdpyvshvylsfyrqetmendiailelsrplkldglkskpaklpdiefrpktgs
dvlvsgygdgtmdpkdhdlksaqltvvdldecrtkygpiflslqvfcaqkvgvslesgda
gdptvqqdtlvgvaayfpkrpegapevftkvgsyvswiqdiikkk

SCOPe Domain Coordinates for d3h7ob_:

Click to download the PDB-style file with coordinates for d3h7ob_.
(The format of our PDB-style files is described here.)

Timeline for d3h7ob_: