Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (20 species) not a true protein |
Species Sarcoptes scabiei [TaxId:197185] [188883] (2 PDB entries) |
Domain d3h7oa_: 3h7o A: [177308] automated match to d1fxya_ complexed with gol, so4 |
PDB Entry: 3h7o (more details), 1.85 Å
SCOPe Domain Sequences for d3h7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h7oa_ b.47.1.0 (A:) automated matches {Sarcoptes scabiei [TaxId: 197185]} kggektdikqvpwtvavrtypgeesltcggailsqwfvltaahcvfdqkpetiviqyest nlwedpgksdpyvshvylsfyrqetmendiailelsrplkldglkskpaklpdiefrpkt gsdvlvsgygdgqtmdpkdhdlksaqltvvdldecrtkygpiflslqvfcaqkvgvsles gdagdptvqqdtlvgvaayfpkrpegapevftkvgsyvswiqdiikkk
Timeline for d3h7oa_: