| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (140 species) not a true protein |
| Species Geobacter sulfurreducens [TaxId:35554] [188938] (1 PDB entry) |
| Domain d3h7ma_: 3h7m A: [177307] automated match to d1wdna_ complexed with na |
PDB Entry: 3h7m (more details), 2.4 Å
SCOPe Domain Sequences for d3h7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h7ma_ c.94.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
rdrhrtivvggdrdyppyefidqngkpagynveltraiaevmgmtvefrlgawsemfsal
ksgrvdvlqgiswsekrarqidftpphtivyhaifarrdsppaagledlrgrkvalhrdg
imheylaergygkdlvltptpadalrllaaggcdyavvamvpgmyiirenrltnlvpvar
siaaqrygyavrqgdaellarfseglailrktgqyeairakwlgvlep
Timeline for d3h7ma_: