Lineage for d3h7ma_ (3h7m A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1009581Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1009582Protein automated matches [190039] (20 species)
    not a true protein
  7. 1009602Species Geobacter sulfurreducens [TaxId:35554] [188938] (1 PDB entry)
  8. 1009603Domain d3h7ma_: 3h7m A: [177307]
    automated match to d1wdna_
    complexed with na

Details for d3h7ma_

PDB Entry: 3h7m (more details), 2.4 Å

PDB Description: crystal structure of a histidine kinase sensor domain with similarity to periplasmic binding proteins
PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d3h7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h7ma_ c.94.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
rdrhrtivvggdrdyppyefidqngkpagynveltraiaevmgmtvefrlgawsemfsal
ksgrvdvlqgiswsekrarqidftpphtivyhaifarrdsppaagledlrgrkvalhrdg
imheylaergygkdlvltptpadalrllaaggcdyavvamvpgmyiirenrltnlvpvar
siaaqrygyavrqgdaellarfseglailrktgqyeairakwlgvlep

SCOPe Domain Coordinates for d3h7ma_:

Click to download the PDB-style file with coordinates for d3h7ma_.
(The format of our PDB-style files is described here.)

Timeline for d3h7ma_: