Lineage for d3h79a_ (3h79 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370833Species Trypanosoma cruzi [TaxId:5693] [188882] (2 PDB entries)
  8. 1370834Domain d3h79a_: 3h79 A: [177301]
    automated match to d2djja1
    complexed with scn

Details for d3h79a_

PDB Entry: 3h79 (more details), 1.5 Å

PDB Description: crystal structure of trypanosoma cruzi thioredoxin-like hypothetical protein q4dv70
PDB Compounds: (A:) thioredoxin-like protein

SCOPe Domain Sequences for d3h79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h79a_ c.47.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
rpsrvveltdetfdsivmdpekdvfvlyyvpwsrhsvaamrlwddlsmsqsqkrnhltfv
aaridgekypdviermrvsgfptmryytridkqepfeysgqrylslvdsfvfqnt

SCOPe Domain Coordinates for d3h79a_:

Click to download the PDB-style file with coordinates for d3h79a_.
(The format of our PDB-style files is described here.)

Timeline for d3h79a_: