Lineage for d1axda1 (1axd A:81-210)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48215Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 48216Domain d1axda1: 1axd A:81-210 [17730]
    Other proteins in same PDB: d1axda2, d1axdb2

Details for d1axda1

PDB Entry: 1axd (more details), 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione

SCOP Domain Sequences for d1axda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axda1 a.45.1.1 (A:81-210) Glutathione S-transferase {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalm

SCOP Domain Coordinates for d1axda1:

Click to download the PDB-style file with coordinates for d1axda1.
(The format of our PDB-style files is described here.)

Timeline for d1axda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axda2