Lineage for d3h6vb_ (3h6v B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162310Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2162319Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 2162505Domain d3h6vb_: 3h6v B: [177298]
    Other proteins in same PDB: d3h6va2
    automated match to d1lbcb_
    complexed with dms, glu, gol, ns6, so4

Details for d3h6vb_

PDB Entry: 3h6v (more details), 2.1 Å

PDB Description: crystal structure of the iglur2 ligand-binding core (s1s2j-n754s) in complex with glutamate and ns5206 at 2.10 a resolution
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3h6vb_:

Sequence, based on SEQRES records: (download)

>d3h6vb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgecg

Sequence, based on observed residues (ATOM records): (download)

>d3h6vb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwykgecg

SCOPe Domain Coordinates for d3h6vb_:

Click to download the PDB-style file with coordinates for d3h6vb_.
(The format of our PDB-style files is described here.)

Timeline for d3h6vb_: