Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin V [64202] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64203] (3 PDB entries) |
Domain d3h6sd_: 3h6s D: [177292] automated match to d1fh0a_ complexed with so4 |
PDB Entry: 3h6s (more details), 2.22 Å
SCOPe Domain Sequences for d3h6sd_:
Sequence, based on SEQRES records: (download)
>d3h6sd_ d.3.1.1 (D:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn skywlvknswgpewgsngyvkiakdknnhcgiataasypnv
>d3h6sd_ d.3.1.1 (D:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} lpksvdwrkkgyvtpvknqkqcgswafsatgalegqmfrktgklvslseqnlvdcsrpqg nqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgkek almkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdns kywlvknswgpewgsngyvkiakdknnhcgiataasypnv
Timeline for d3h6sd_: