SCOPe 2.08: Domain d3h6sc_: 3h6s C:

Lineage for d3h6sc_ (3h6s C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin V [64202] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64203] (3 PDB entries)

8. Domain d3h6sc_: 3h6s C: [177291]
   automated match to d1fh0a_
   complexed with so4

Details for d3h6sc_

PDB Entry: 3h6s, 2.22 Å

PDB Description: structure of clitocypin - cathepsin v complex

PDB Compounds: (C:) Cathepsin L2

SCOPe Domain Sequences for d3h6sc_:

Sequence, based on SEQRES records:

>d3h6sc_ d.3.1.1 (C:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]}
lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
skywlvknswgpewgsngyvkiakdknnhcgiataasypnv

Sequence, based on observed residues (ATOM records):

>d3h6sc_ d.3.1.1 (C:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]}
lpksvdwrkkgyvtpvknqkqcgswafsatgalegqmfrktgklvslseqnlvdcsrpqg
nqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgkek
almkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdns
kywlvknswgpewgsngyvkiakdknnhcgiataasypnv

Timeline for d3h6sc_:

• d3h6sc_ first appeared in SCOPe 2.01
  
• d3h6sc_ appears in SCOPe 2.07