Lineage for d3h6sb_ (3h6s B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926748Protein (Pro)cathepsin V [64202] (1 species)
  7. 2926749Species Human (Homo sapiens) [TaxId:9606] [64203] (3 PDB entries)
  8. 2926755Domain d3h6sb_: 3h6s B: [177290]
    automated match to d1fh0a_
    complexed with so4

Details for d3h6sb_

PDB Entry: 3h6s (more details), 2.22 Å

PDB Description: structure of clitocypin - cathepsin v complex
PDB Compounds: (B:) Cathepsin L2

SCOPe Domain Sequences for d3h6sb_:

Sequence, based on SEQRES records: (download)

>d3h6sb_ d.3.1.1 (B:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]}
lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
skywlvknswgpewgsngyvkiakdknnhcgiataasypnv

Sequence, based on observed residues (ATOM records): (download)

>d3h6sb_ d.3.1.1 (B:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]}
lpksvdwrkkgyvtpvknqkqcgswafsatgalegqmfrktgklvslseqnlvdcsrpqg
nqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgkek
almkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdns
kywlvknswgpewgsngyvkiakdknnhcgiataasypnv

SCOPe Domain Coordinates for d3h6sb_:

Click to download the PDB-style file with coordinates for d3h6sb_.
(The format of our PDB-style files is described here.)

Timeline for d3h6sb_: