Lineage for d1gnwb1 (1gnw B:86-211)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713190Protein Class phi GST [81356] (3 species)
  7. 2713200Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 2713203Domain d1gnwb1: 1gnw B:86-211 [17728]
    Other proteins in same PDB: d1gnwa2, d1gnwb2
    complexed with gtx

Details for d1gnwb1

PDB Entry: 1gnw (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1gnwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnwb1 a.45.1.1 (B:86-211) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOPe Domain Coordinates for d1gnwb1:

Click to download the PDB-style file with coordinates for d1gnwb1.
(The format of our PDB-style files is described here.)

Timeline for d1gnwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnwb2