Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class phi GST [81356] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries) |
Domain d1gnwa1: 1gnw A:86-211 [17727] Other proteins in same PDB: d1gnwa2, d1gnwb2 complexed with gtx |
PDB Entry: 1gnw (more details), 2.2 Å
SCOPe Domain Sequences for d1gnwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp asekvq
Timeline for d1gnwa1: