Lineage for d1gnwa1 (1gnw A:86-211)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3883Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 3884Domain d1gnwa1: 1gnw A:86-211 [17727]
    Other proteins in same PDB: d1gnwa2, d1gnwb2

Details for d1gnwa1

PDB Entry: 1gnw (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase

SCOP Domain Sequences for d1gnwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnwa1 a.45.1.1 (A:86-211) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOP Domain Coordinates for d1gnwa1:

Click to download the PDB-style file with coordinates for d1gnwa1.
(The format of our PDB-style files is described here.)

Timeline for d1gnwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnwa2