SCOPe 2.08: Domain d1gnwa1: 1gnw A:86-211

Lineage for d1gnwa1 (1gnw A:86-211)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class phi GST [81356] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)

8. Domain d1gnwa1: 1gnw A:86-211 [17727]
   Other proteins in same PDB: d1gnwa2, d1gnwb2
   complexed with gtx

Details for d1gnwa1

PDB Entry: 1gnw, 2.2 Å

PDB Description: structure of glutathione s-transferase

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gnwa1:

Sequence; same for both SEQRES and ATOM records:

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

Timeline for d1gnwa1:

• d1gnwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1gnwa1 appears in SCOPe 2.07