Lineage for d3h6ie_ (3h6i E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1937002Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1937065Domain d3h6ie_: 3h6i E: [177262]
    automated match to d1q5qh_
    complexed with dmf

Details for d3h6ie_

PDB Entry: 3h6i (more details), 2.43 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome Modified by inhibitor GL1
PDB Compounds: (E:) Proteasome (Beta subunit) PrcB

SCOPe Domain Sequences for d3h6ie_:

Sequence, based on SEQRES records: (download)

>d3h6ie_ d.153.1.4 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

Sequence, based on observed residues (ATOM records): (download)

>d3h6ie_ d.153.1.4 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
vrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d3h6ie_:

Click to download the PDB-style file with coordinates for d3h6ie_.
(The format of our PDB-style files is described here.)

Timeline for d3h6ie_: