SCOPe 2.01: Domain d1fhea1: 1fhe A:81-214

Lineage for d1fhea1 (1fhe A:81-214)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)

8. Domain d1fhea1: 1fhe A:81-214 [17726]
   Other proteins in same PDB: d1fhea2
   complexed with gsw

Details for d1fhea1

PDB Entry: 1fhe, 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1fhea1:

Sequence; same for both SEQRES and ATOM records:

>d1fhea1 a.45.1.1 (A:81-214) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
lgttpeerarismiegaamdlrigfgrvcynpkfeevkeeyvkelpktlkmwsdflgdrh
yltgssvshvdfmlyetldsirylaphcldefpklkefksriealpkikaymeskrfikw
plngwaasfgagda

Timeline for d1fhea1:

• d1fhea1 first appeared (with stable ids) in SCOP 1.55, called d1fhe_1
  
• d1fhea1 appears in SCOP 1.75
  
• d1fhea1 appears in SCOPe 2.02
  
• d1fhea1 appears in the current release, SCOPe 2.08