Lineage for d1fhe_1 (1fhe 81-214)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins) Protein Glutathione S-transferase [47618] (24 species) 
Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries) 
Domain d1fhe_1: 1fhe 81-214 [17726]
Other proteins in same PDB: d1fhe_2
Details for d1fhe_1
PDB Entry: 1fhe (more details), 3 Å
PDB Description: glutathione transferase (fh47) from fasciola hepatica
SCOP Domain Sequences for d1fhe_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhe_1 a.45.1.1 (81-214) Glutathione S-transferase {Fasciola hepatica}
lgttpeerarismiegaamdlrigfgrvcynpkfeevkeeyvkelpktlkmwsdflgdrh
yltgssvshvdfmlyetldsirylaphcldefpklkefksriealpkikaymeskrfikw
plngwaasfgagda
SCOP Domain Coordinates for d1fhe_1:
Click to download the PDB-style file with coordinates for d1fhe_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fhe_1:
- d1fhe_1 first appeared (with stable ids) in SCOP 1.55
- d1fhe_1 appears in SCOP 1.59
- d1fhe_1 appears in the current release, SCOPe 2.08, called d1fhea1
View in 3D
