Lineage for d1fhea1 (1fhe A:81-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2321907Protein Class alpha GST [81349] (8 species)
  7. 2321916Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)
  8. 2321919Domain d1fhea1: 1fhe A:81-214 [17726]
    Other proteins in same PDB: d1fhea2
    complexed with gsh

Details for d1fhea1

PDB Entry: 1fhe (more details), 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1fhea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhea1 a.45.1.1 (A:81-214) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
lgttpeerarismiegaamdlrigfgrvcynpkfeevkeeyvkelpktlkmwsdflgdrh
yltgssvshvdfmlyetldsirylaphcldefpklkefksriealpkikaymeskrfikw
plngwaasfgagda

SCOPe Domain Coordinates for d1fhea1:

Click to download the PDB-style file with coordinates for d1fhea1.
(The format of our PDB-style files is described here.)

Timeline for d1fhea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhea2