SCOPe 2.02: Domain d2fhea1: 2fhe A:81-216

Lineage for d2fhea1 (2fhe A:81-216)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)

8. Domain d2fhea1: 2fhe A:81-216 [17724]
   Other proteins in same PDB: d2fhea2, d2fheb2
   complexed with gsh

Details for d2fhea1

PDB Entry: 2fhe, 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2fhea1:

Sequence; same for both SEQRES and ATOM records:

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp
ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw
plngwhaqfgggdapp

Timeline for d2fhea1:

• d2fhea1 first appeared (with stable ids) in SCOP 1.55
  
• d2fhea1 appears in SCOPe 2.01
  
• d2fhea1 appears in SCOPe 2.03
  
• d2fhea1 appears in the current release, SCOPe 2.08