Class a: All alpha proteins [46456] (226 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries) |
Domain d2fhea1: 2fhe A:81-216 [17724] Other proteins in same PDB: d2fhea2, d2fheb2 |
PDB Entry: 2fhe (more details), 2.3 Å
SCOP Domain Sequences for d2fhea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica} igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw plngwhaqfgggdapp
Timeline for d2fhea1: